Started ../../scripts/make-features.py 2020-04-15 14:08:41.643552
Fasta: /home/badri/PDNET/v4-pssmbugfix/data/cameo/fasta/5Y08_A.fasta
ID: 5Y08_A
Outdir: /home/badri/PDNET/v4-pssmbugfix/data/cameo/raw-features/5Y08_A
A3mfile: /home/badri/PDNET/v4-pssmbugfix/data/cameo/cameo_a3m/5Y08_A.a3m
L: 205
Seq: GSHMNDVTTETYETLKQSVLHTFAQLTGYNVSELSLTSHLENDLGVDSIALAEIAVSLSRQFQLNTPLLIQDINTIKDALDGILQREFQLSEKVEPAAIALSGDADLWLGNLVRQIFASHSGYDVNALALDAEIESDLGIDSVSVASAQGELFNTLQLNSETIIANCNTLSALKQCLAARLVQEKGQDWFELTRAPPPPPLRSGC

Predict secondary structures..
SS already done!

Predict solvent accessibility..
SA already done!

Using existing a3m alignment file..

Clean A3M..

Genrate aln from a3m..
10790 5Y08_A.a3m
5395 5Y08_A.aln
ALN already done!


Run alnstats..
alnstats already done!

Run CCMpred..
ALN already done!

Run FreeContact..
ALN already done!

Generate PSSM from alignment (write pssm)..
2020-04-15 14:08:44.569906: I tensorflow/stream_executor/platform/default/dso_loader.cc:44] Successfully opened dynamic library libcuda.so.1
2020-04-15 14:08:44.574712: E tensorflow/stream_executor/cuda/cuda_driver.cc:318] failed call to cuInit: CUDA_ERROR_NO_DEVICE: no CUDA-capable device is detected
2020-04-15 14:08:44.574789: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:169] retrieving CUDA diagnostic information for host: prayog02
2020-04-15 14:08:44.574800: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:176] hostname: prayog02
2020-04-15 14:08:44.574898: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:200] libcuda reported version is: 415.27.0
2020-04-15 14:08:44.574963: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:204] kernel reported version is: 415.27.0
2020-04-15 14:08:44.574974: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:310] kernel version seems to match DSO: 415.27.0
2020-04-15 14:08:44.575403: I tensorflow/core/platform/cpu_feature_guard.cc:142] Your CPU supports instructions that this TensorFlow binary was not compiled to use: AVX2 AVX512F FMA
2020-04-15 14:08:44.603143: I tensorflow/core/platform/profile_utils/cpu_utils.cc:94] CPU Frequency: 1700000000 Hz
2020-04-15 14:08:44.604140: I tensorflow/compiler/xla/service/service.cc:168] XLA service 0x46ef0e0 executing computations on platform Host. Devices:
2020-04-15 14:08:44.604192: I tensorflow/compiler/xla/service/service.cc:175]   StreamExecutor device (0): <undefined>, <undefined>
msa1hot (5395, 205, 21) w (5395,)
f1d_pssm (205, 22)
saved 5Y08_A.pssm.npy

Write feature file..
done ../../scripts/make-features.py 2020-04-15 14:08:46.688180