Started ../../scripts/make-features.py 2020-04-15 13:56:31.861364
Fasta: /home/badri/PDNET/v4-pssmbugfix/data/cameo/fasta/6AE9_B.fasta
ID: 6AE9_B
Outdir: /home/badri/PDNET/v4-pssmbugfix/data/cameo/raw-features/6AE9_B
A3mfile: /home/badri/PDNET/v4-pssmbugfix/data/cameo/cameo_a3m/6AE9_B.a3m
L: 260
Seq: GLTIGTHLIPHPRKAETGGEDAFFVNGDDGGVFAVADGVSGWAEKDVNPALFSRELMAHTSTFLKDEEVNHDPQLLLMKAHAATTSVGSATVIIAMLEKTGILKIASVGDCGLKVIRKGQVMFSTCPQEHYFDCPYQLSSEAIGQTYLDALVCTVNLMEGDMIVSGSDGFFDNIFDQEIVSVISESPGVDEAAKALAELARKHSVDVTFDSPYSMEARSRGFDVPSWKKFIGGKLIGGKMNDITVIVAQVKALEHHHHHH

Predict secondary structures..
SS already done!

Predict solvent accessibility..
SA already done!

Using existing a3m alignment file..

Clean A3M..

Genrate aln from a3m..
6780 6AE9_B.a3m
3390 6AE9_B.aln
ALN already done!


Run alnstats..
alnstats already done!

Run CCMpred..
ALN already done!

Run FreeContact..
ALN already done!

Generate PSSM from alignment (write pssm)..
2020-04-15 13:56:34.818424: I tensorflow/stream_executor/platform/default/dso_loader.cc:44] Successfully opened dynamic library libcuda.so.1
2020-04-15 13:56:34.823127: E tensorflow/stream_executor/cuda/cuda_driver.cc:318] failed call to cuInit: CUDA_ERROR_NO_DEVICE: no CUDA-capable device is detected
2020-04-15 13:56:34.823208: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:169] retrieving CUDA diagnostic information for host: prayog02
2020-04-15 13:56:34.823219: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:176] hostname: prayog02
2020-04-15 13:56:34.823318: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:200] libcuda reported version is: 415.27.0
2020-04-15 13:56:34.823359: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:204] kernel reported version is: 415.27.0
2020-04-15 13:56:34.823368: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:310] kernel version seems to match DSO: 415.27.0
2020-04-15 13:56:34.823794: I tensorflow/core/platform/cpu_feature_guard.cc:142] Your CPU supports instructions that this TensorFlow binary was not compiled to use: AVX2 AVX512F FMA
2020-04-15 13:56:34.855123: I tensorflow/core/platform/profile_utils/cpu_utils.cc:94] CPU Frequency: 1700000000 Hz
2020-04-15 13:56:34.856216: I tensorflow/compiler/xla/service/service.cc:168] XLA service 0x512a200 executing computations on platform Host. Devices:
2020-04-15 13:56:34.856279: I tensorflow/compiler/xla/service/service.cc:175]   StreamExecutor device (0): <undefined>, <undefined>
msa1hot (3390, 260, 21) w (3390,)
f1d_pssm (260, 22)
saved 6AE9_B.pssm.npy

Write feature file..
done ../../scripts/make-features.py 2020-04-15 13:56:36.376898