Started ../../scripts/make-features.py 2020-04-15 13:56:40.999662
Fasta: /home/badri/PDNET/v4-pssmbugfix/data/cameo/fasta/6AKJ_B.fasta
ID: 6AKJ_B
Outdir: /home/badri/PDNET/v4-pssmbugfix/data/cameo/raw-features/6AKJ_B
A3mfile: /home/badri/PDNET/v4-pssmbugfix/data/cameo/cameo_a3m/6AKJ_B.a3m
L: 155
Seq: MGHHHHHHMSPPPAESHIILLIQQGSDPKTRIWSDHCSLRSAIEYIVGVYQTNQAVSEKESIDVSRFFNFFDEIYDCVPLVYDRHFRAYIPHEKQWLLHHAQEYLTAARQIPGSSGSSGSSGSSGSSGKYDFSRHCTDYGHSYEWPYFRSLRRES

Predict secondary structures..
SS already done!

Predict solvent accessibility..
SA already done!

Using existing a3m alignment file..

Clean A3M..

Genrate aln from a3m..
2424 6AKJ_B.a3m
1212 6AKJ_B.aln
ALN already done!


Run alnstats..
alnstats already done!

Run CCMpred..
ALN already done!

Run FreeContact..
ALN already done!

Generate PSSM from alignment (write pssm)..
2020-04-15 13:56:43.916256: I tensorflow/stream_executor/platform/default/dso_loader.cc:44] Successfully opened dynamic library libcuda.so.1
2020-04-15 13:56:43.920869: E tensorflow/stream_executor/cuda/cuda_driver.cc:318] failed call to cuInit: CUDA_ERROR_NO_DEVICE: no CUDA-capable device is detected
2020-04-15 13:56:43.920937: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:169] retrieving CUDA diagnostic information for host: prayog02
2020-04-15 13:56:43.920949: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:176] hostname: prayog02
2020-04-15 13:56:43.921051: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:200] libcuda reported version is: 415.27.0
2020-04-15 13:56:43.921093: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:204] kernel reported version is: 415.27.0
2020-04-15 13:56:43.921103: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:310] kernel version seems to match DSO: 415.27.0
2020-04-15 13:56:43.921537: I tensorflow/core/platform/cpu_feature_guard.cc:142] Your CPU supports instructions that this TensorFlow binary was not compiled to use: AVX2 AVX512F FMA
2020-04-15 13:56:43.951123: I tensorflow/core/platform/profile_utils/cpu_utils.cc:94] CPU Frequency: 1700000000 Hz
2020-04-15 13:56:43.952206: I tensorflow/compiler/xla/service/service.cc:168] XLA service 0x5e69970 executing computations on platform Host. Devices:
2020-04-15 13:56:43.952267: I tensorflow/compiler/xla/service/service.cc:175]   StreamExecutor device (0): <undefined>, <undefined>
msa1hot (1212, 155, 21) w (1212,)
f1d_pssm (155, 22)
saved 6AKJ_B.pssm.npy

Write feature file..
done ../../scripts/make-features.py 2020-04-15 13:56:44.625996