Started ../../scripts/make-features.py 2020-04-15 14:10:40.784210 Fasta: /home/badri/PDNET/v4-pssmbugfix/data/cameo/fasta/6DLC_A.fasta ID: 6DLC_A Outdir: /home/badri/PDNET/v4-pssmbugfix/data/cameo/raw-features/6DLC_A A3mfile: /home/badri/PDNET/v4-pssmbugfix/data/cameo/cameo_a3m/6DLC_A.a3m L: 115 Seq: MDSDEHLYKLKTFLENLRRHLDRLDKHIKQLRDILSENPEDERVKDAIDLSERSVRIVKTVIKIFEDSVRKKEKRPIDKRDDKELDKLLDTLEKILQTATKIIDDANKLLEYLRR Predict secondary structures.. SS already done! Predict solvent accessibility.. SA already done! Using existing a3m alignment file.. Clean A3M.. Genrate aln from a3m.. 33574 6DLC_A.a3m 16787 6DLC_A.aln ALN already done! Run alnstats.. alnstats already done! Run CCMpred.. ALN already done! Run FreeContact.. ALN already done! Generate PSSM from alignment (write pssm).. 2020-04-15 14:10:44.015121: I tensorflow/stream_executor/platform/default/dso_loader.cc:44] Successfully opened dynamic library libcuda.so.1 2020-04-15 14:10:44.020050: E tensorflow/stream_executor/cuda/cuda_driver.cc:318] failed call to cuInit: CUDA_ERROR_NO_DEVICE: no CUDA-capable device is detected 2020-04-15 14:10:44.020123: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:169] retrieving CUDA diagnostic information for host: prayog02 2020-04-15 14:10:44.020134: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:176] hostname: prayog02 2020-04-15 14:10:44.020240: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:200] libcuda reported version is: 415.27.0 2020-04-15 14:10:44.020292: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:204] kernel reported version is: 415.27.0 2020-04-15 14:10:44.020303: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:310] kernel version seems to match DSO: 415.27.0 2020-04-15 14:10:44.021813: I tensorflow/core/platform/cpu_feature_guard.cc:142] Your CPU supports instructions that this TensorFlow binary was not compiled to use: AVX2 AVX512F FMA 2020-04-15 14:10:44.059135: I tensorflow/core/platform/profile_utils/cpu_utils.cc:94] CPU Frequency: 1700000000 Hz 2020-04-15 14:10:44.060221: I tensorflow/compiler/xla/service/service.cc:168] XLA service 0x55d4cf0 executing computations on platform Host. Devices: 2020-04-15 14:10:44.060261: I tensorflow/compiler/xla/service/service.cc:175] StreamExecutor device (0): , msa1hot (16787, 115, 21) w (16787,) f1d_pssm (115, 22) saved 6DLC_A.pssm.npy Write feature file.. done ../../scripts/make-features.py 2020-04-15 14:10:52.482727