Started ../../scripts/make-features.py 2020-04-15 13:42:15.426130
Fasta: /home/badri/PDNET/v4-pssmbugfix/data/cameo/fasta/6G8Y_A.fasta
ID: 6G8Y_A
Outdir: /home/badri/PDNET/v4-pssmbugfix/data/cameo/raw-features/6G8Y_A
A3mfile: /home/badri/PDNET/v4-pssmbugfix/data/cameo/cameo_a3m/6G8Y_A.a3m
L: 92
Seq: DDDDKMLEVLFQGPGLRIVWVDEMQFQLQSFFDYIVGFNDDPVPVVSNQHGFSYPDYRRITSIFNEHCGRTLKVNIWSAKGGTFRDEYISII

Predict secondary structures..
SS already done!

Predict solvent accessibility..
SA already done!

Using existing a3m alignment file..

Clean A3M..

Genrate aln from a3m..
21936 6G8Y_A.a3m
10968 6G8Y_A.aln
ALN already done!


Run alnstats..
alnstats already done!

Run CCMpred..
ALN already done!

Run FreeContact..
ALN already done!

Generate PSSM from alignment (write pssm)..
2020-04-15 13:42:18.321133: I tensorflow/stream_executor/platform/default/dso_loader.cc:44] Successfully opened dynamic library libcuda.so.1
2020-04-15 13:42:18.325892: E tensorflow/stream_executor/cuda/cuda_driver.cc:318] failed call to cuInit: CUDA_ERROR_NO_DEVICE: no CUDA-capable device is detected
2020-04-15 13:42:18.325968: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:169] retrieving CUDA diagnostic information for host: prayog02
2020-04-15 13:42:18.325980: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:176] hostname: prayog02
2020-04-15 13:42:18.326086: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:200] libcuda reported version is: 415.27.0
2020-04-15 13:42:18.326126: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:204] kernel reported version is: 415.27.0
2020-04-15 13:42:18.326136: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:310] kernel version seems to match DSO: 415.27.0
2020-04-15 13:42:18.326546: I tensorflow/core/platform/cpu_feature_guard.cc:142] Your CPU supports instructions that this TensorFlow binary was not compiled to use: AVX2 AVX512F FMA
2020-04-15 13:42:18.355152: I tensorflow/core/platform/profile_utils/cpu_utils.cc:94] CPU Frequency: 1700000000 Hz
2020-04-15 13:42:18.356162: I tensorflow/compiler/xla/service/service.cc:168] XLA service 0x54ded00 executing computations on platform Host. Devices:
2020-04-15 13:42:18.356204: I tensorflow/compiler/xla/service/service.cc:175]   StreamExecutor device (0): <undefined>, <undefined>
msa1hot (10968, 92, 21) w (10968,)
f1d_pssm (92, 22)
saved 6G8Y_A.pssm.npy

Write feature file..
done ../../scripts/make-features.py 2020-04-15 13:42:21.966679