Started ../../scripts/make-features.py 2020-04-15 14:09:22.620751 Fasta: /home/badri/PDNET/v4-pssmbugfix/data/cameo/fasta/6H6N_B.fasta ID: 6H6N_B Outdir: /home/badri/PDNET/v4-pssmbugfix/data/cameo/raw-features/6H6N_B A3mfile: /home/badri/PDNET/v4-pssmbugfix/data/cameo/cameo_a3m/6H6N_B.a3m L: 131 Seq: MELHHHHHHEEMPFKPLVTAGIESLLNTFLYRSPALKTARSRLLGKVLRVEVKGFSTSLILVFSERQVDVLGEWAGDADCTVIAYASVLPKLRDRQQLTALIRSGELEVQGDIQVVQNFVALADLAEFDPA Predict secondary structures.. SS already done! Predict solvent accessibility.. SA already done! Using existing a3m alignment file.. Clean A3M.. Genrate aln from a3m.. 61030 6H6N_B.a3m 30515 6H6N_B.aln ALN already done! Run alnstats.. alnstats already done! Run CCMpred.. ALN already done! Run FreeContact.. ALN already done! Generate PSSM from alignment (write pssm).. 2020-04-15 14:09:26.254095: I tensorflow/stream_executor/platform/default/dso_loader.cc:44] Successfully opened dynamic library libcuda.so.1 2020-04-15 14:09:26.259020: E tensorflow/stream_executor/cuda/cuda_driver.cc:318] failed call to cuInit: CUDA_ERROR_NO_DEVICE: no CUDA-capable device is detected 2020-04-15 14:09:26.259094: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:169] retrieving CUDA diagnostic information for host: prayog02 2020-04-15 14:09:26.259107: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:176] hostname: prayog02 2020-04-15 14:09:26.259209: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:200] libcuda reported version is: 415.27.0 2020-04-15 14:09:26.259255: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:204] kernel reported version is: 415.27.0 2020-04-15 14:09:26.259265: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:310] kernel version seems to match DSO: 415.27.0 2020-04-15 14:09:26.260009: I tensorflow/core/platform/cpu_feature_guard.cc:142] Your CPU supports instructions that this TensorFlow binary was not compiled to use: AVX2 AVX512F FMA 2020-04-15 14:09:26.291151: I tensorflow/core/platform/profile_utils/cpu_utils.cc:94] CPU Frequency: 1700000000 Hz 2020-04-15 14:09:26.291980: I tensorflow/compiler/xla/service/service.cc:168] XLA service 0x50816b0 executing computations on platform Host. Devices: 2020-04-15 14:09:26.292020: I tensorflow/compiler/xla/service/service.cc:175] StreamExecutor device (0): , 2020-04-15 14:09:26.563881: W tensorflow/core/framework/cpu_allocator_impl.cc:81] Allocation of 3724660900 exceeds 10% of system memory. 2020-04-15 14:09:53.019677: W tensorflow/core/framework/cpu_allocator_impl.cc:81] Allocation of 3724660900 exceeds 10% of system memory. msa1hot (30515, 131, 21) w (30515,) f1d_pssm (131, 22) saved 6H6N_B.pssm.npy Write feature file.. done ../../scripts/make-features.py 2020-04-15 14:09:55.075671