Started ../../scripts/make-features.py 2020-04-15 13:39:47.470436
Fasta: /home/badri/PDNET/v4-pssmbugfix/data/cameo/fasta/6HC2_X.fasta
ID: 6HC2_X
Outdir: /home/badri/PDNET/v4-pssmbugfix/data/cameo/raw-features/6HC2_X
A3mfile: /home/badri/PDNET/v4-pssmbugfix/data/cameo/cameo_a3m/6HC2_X.a3m
L: 71
Seq: GPLGSPDYGNSALLSLPGYRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDDWNRIAELQQRNR

Predict secondary structures..
SS already done!

Predict solvent accessibility..
SA already done!

Using existing a3m alignment file..

Clean A3M..

Genrate aln from a3m..
131070 6HC2_X.a3m
65535 6HC2_X.aln
ALN already done!


Run alnstats..
alnstats already done!

Run CCMpred..
ALN already done!

Run FreeContact..
ALN already done!

Generate PSSM from alignment (write pssm)..
2020-04-15 13:39:51.526545: I tensorflow/stream_executor/platform/default/dso_loader.cc:44] Successfully opened dynamic library libcuda.so.1
2020-04-15 13:39:51.531292: E tensorflow/stream_executor/cuda/cuda_driver.cc:318] failed call to cuInit: CUDA_ERROR_NO_DEVICE: no CUDA-capable device is detected
2020-04-15 13:39:51.531363: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:169] retrieving CUDA diagnostic information for host: prayog02
2020-04-15 13:39:51.531375: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:176] hostname: prayog02
2020-04-15 13:39:51.531479: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:200] libcuda reported version is: 415.27.0
2020-04-15 13:39:51.531520: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:204] kernel reported version is: 415.27.0
2020-04-15 13:39:51.531530: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:310] kernel version seems to match DSO: 415.27.0
2020-04-15 13:39:51.532158: I tensorflow/core/platform/cpu_feature_guard.cc:142] Your CPU supports instructions that this TensorFlow binary was not compiled to use: AVX2 AVX512F FMA
2020-04-15 13:39:51.563178: I tensorflow/core/platform/profile_utils/cpu_utils.cc:94] CPU Frequency: 1700000000 Hz
2020-04-15 13:39:51.564206: I tensorflow/compiler/xla/service/service.cc:168] XLA service 0x5ec9830 executing computations on platform Host. Devices:
2020-04-15 13:39:51.564269: I tensorflow/compiler/xla/service/service.cc:175]   StreamExecutor device (0): <undefined>, <undefined>
2020-04-15 13:39:51.845811: W tensorflow/core/framework/cpu_allocator_impl.cc:81] Allocation of 17179344900 exceeds 10% of system memory.
2020-04-15 13:41:14.082816: W tensorflow/core/framework/cpu_allocator_impl.cc:81] Allocation of 17179344900 exceeds 10% of system memory.
msa1hot (65535, 71, 21) w (65535,)
f1d_pssm (71, 22)
saved 6HC2_X.pssm.npy

Write feature file..
done ../../scripts/make-features.py 2020-04-15 13:41:21.194402